PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000148548
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family Dof
Protein Properties Length: 134aa    MW: 14739.5 Da    PI: 10.9621
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000148548genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.6e-393291362
         zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                   ++alkcprCds ntkfCyynny+ sqPr+fCkaCrryWtkGG lrnvP+Ggg+rk k+s+
  MDP0000148548 32 QHALKCPRCDSLNTKFCYYNNYNFSQPRHFCKACRRYWTKGGVLRNVPIGGGCRKTKRSQ 91
                   6789****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-263089IPR003851Zinc finger, Dof-type
PfamPF027011.5E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3013589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MQDIHSVRGG GRFFGGSGGG DPRLRPHQHP NQHALKCPRC DSLNTKFCYY NNYNFSQPRH  60
FCKACRRYWT KGGVLRNVPI GGGCRKTKRS QTKNSSSSSP ISSPSPEGGF STSTCTTASP  120
PATVNHRFSS AQFR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.123881e-166fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572542e-60DQ857254.1 Glycine max Dof4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348381.18e-64PREDICTED: dof zinc finger protein DOF3.6-like
SwissprotQ8LDR02e-39DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLD9ZIX75e-50D9ZIX7_MALDO; DOF domain class transcription factor
STRINGGLYMA17G08950.18e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-37OBF binding protein 4